Web Hosting Plans | Registrazione Domini | Server Dedicati | Multi Domain Hosting Plans | EUROPEAN DEDICATED SERVER | VPS | DEDICATED SERVER IN EUROPE

ENGLISH SPANISH ITALIAN
Chi siamo Servizi Area riservata Supporto WebMail Contatti
HOMEPAGE SITEMAP EMAIL
EUROPEANWEBHOST.COM - SERVER DEDICATI

Se hai bisogno di un server tutto tuo, Europeanwebhost ha quello che fa per te. I Server dedicati velocissimi e super affidabili, monitorati 24h su 24h, 7 giorni su 7. L'uptime garantito è del 99,9%. Il nostro personale è in grado di offrirti una elevata professionalità e competenza, il nostro supporto tecnico sarà a tua disposizione per qualsiasi richiesta.

I server disponibili sono di questo tipo:

DUAL PROCESSOR MULTI CORE

QUAD PROCESSOR MULTI CORE

Ram, HD, Uplink ecc, sono personalizzabili. Vi invitiamo a scriverci per avere un preventivo su misura per voi

windows_server_2003centos
aspnetaspfpphpmysqlperlphpmyadmin

EUROPEANWEBHOST, S.L.
C/Atardecer 4, Ptal. A Puerta 19 ´┐Ż 38530 Candelaria (S.C. de Tenerife)
Registro Mercantil de S.C. de Tenerife ´┐Ż Tomo 3225 ´┐Ż Folio 31 ´┐Ż Hoja TF-49963 ´┐Ż Inscripción 1 ´┐Ż CIF B76568591