Web Hosting Plans | Registrazione Domini | Server Dedicati | Multi Domain Hosting Plans | EUROPEAN DEDICATED SERVER | VPS | DEDICATED SERVER IN EUROPE

ENGLISH SPANISH ITALIAN
Chi siamo Servizi Area riservata Supporto WebMail Contatti
HOMEPAGE SITEMAP EMAIL
EUROPEANWEBHOST.COM - GESTIONE DNS e URL FORWARD

La registrazione di qualsiasi nome a dominio come ad esempio .it - .com - .net - .org - .biz - .info - .eu comprende un pannello di amministrazione per la gestione dei dns e url forwarding avendo così la possibilità di far puntare il dominio ed email su un altro spazio web.

Il costo del piano hosting redirect+dns comprende la registrazione e mantenimento di un dominio con estensione .it - .org - .info - .eu intestato a tuo nome.

OPZIONI AGGIUNTIVE
  prezzo
5 sotto domini € 5
10 sotto domini € 8
25 sotto domini € 18
50 sotto domini € 49
100 sotto domini € 61
Database MySql aggiuntivo € 7
cartelle protette € 7
certificato e supporto ssl * €82
statistiche awstats € 7
Protezione dati Whois € 6
pagine d'errore personalizzate € 7
IP dedicato € 33
traffico aggiuntivo 5 gb € 5
traffico aggiuntivo 10 gb € 9
traffico aggiuntivo 25 gb € 20
traffico aggiuntivo 50 gb € 37
traffico aggiuntivo 100 gb € 70
traffico aggiuntivo 250 gb € 140
traffico aggiuntivo 500 gb € 260
* il prezzo include un indirizzo ip dedicato
ALTRI TLD DISPONIBILI
  prezzo
dominio .com € 9
dominio .net € 9
dominio .biz € 9
dominio .mobi € 20
dominio .ch € 19
dominio .ws € 25
dominio .cc € 30
dominio .name € 20
dominio .in € 25
dominio .tv € 30
dominio .me € 25
dominio .es € 8
dominio .co.uk € 9
dominio .co.in € 11
dominio .co € 29
dominio .pe € 38
dominio .li € 20
 
 
tariffa annuale - chiedere regolamento
windows_server_2003centos
aspnetaspfpphpmysqlperlphpmyadmin

EUROPEANWEBHOST, S.L.
C/Atardecer 4, Ptal. A Puerta 19 � 38530 Candelaria (S.C. de Tenerife)
Registro Mercantil de S.C. de Tenerife � Tomo 3225 � Folio 31 � Hoja TF-49963 � Inscripción 1 � CIF B76568591